PDB entry 3wib

View 3wib on RCSB PDB site
Description: Crystal structure of Y109W Mutant Haloalkane Dehalogenase DatA from Agrobacterium tumefaciens C58
Class: hydrolase
Keywords: haloalkane dehalogenase, hydrolase fold family, hydrolase
Deposited on 2013-09-09, released 2014-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: dhaA, dha, Atu6064, AGR_pTi_130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U671
      • engineered mutation (114)
    Domains in SCOPe 2.06: d3wiba_
  • Chain 'B':
    Compound: haloalkane dehalogenase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: dhaA, dha, Atu6064, AGR_pTi_130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U671
      • engineered mutation (114)
    Domains in SCOPe 2.06: d3wibb_
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wibA (A:)
    mkehrhmteksphsafgdgakaydvpafglqihtvehgsgapivflhgnptssylwrhif
    rrlhghgrllavdligygqsskpdieytlenqqryvdawfdaldlrnvtlvlqdwgaafg
    lnwasrnpdrvravaffepvlrnidsvdlspefvtrraklrqpgegeifvqqenrfltel
    fpwffltplapedlrqyqtpfptphsrkailagprnlpvdgepastvafleqavnwlnts
    dtpkllltfkpgflltdailkwsqvtirnleieaagagihfvqeeqpetiarlldawltr
    iagn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wibA (A:)
    phsafgdgakaydvpafglqihtvehgsgapivflhgnptssylwrhifrrlhghgrlla
    vdligygqsskpdieytlenqqryvdawfdaldlrnvtlvlqdwgaafglnwasrnpdrv
    ravaffepvlrnidsvdlspefvtrraklrqpgegeifvqqenrfltelfpwffltplap
    edlrqyqtpfptphsrkailagprnlpvdgepastvafleqavnwlntsdtpkllltfkp
    gflltdailkwsqvtirnleieaagagihfvqeeqpetiarlldawltr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wibB (B:)
    mkehrhmteksphsafgdgakaydvpafglqihtvehgsgapivflhgnptssylwrhif
    rrlhghgrllavdligygqsskpdieytlenqqryvdawfdaldlrnvtlvlqdwgaafg
    lnwasrnpdrvravaffepvlrnidsvdlspefvtrraklrqpgegeifvqqenrfltel
    fpwffltplapedlrqyqtpfptphsrkailagprnlpvdgepastvafleqavnwlnts
    dtpkllltfkpgflltdailkwsqvtirnleieaagagihfvqeeqpetiarlldawltr
    iagn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wibB (B:)
    phsafgdgakaydvpafglqihtvehgsgapivflhgnptssylwrhifrrlhghgrlla
    vdligygqsskpdieytlenqqryvdawfdaldlrnvtlvlqdwgaafglnwasrnpdrv
    ravaffepvlrnidsvdlspefvtrraklrqpgegeifvqqenrfltelfpwffltplap
    edlrqyqtpfptphsrkailagprnlpvdgepastvafleqavnwlntsdtpkllltfkp
    gflltdailkwsqvtirnleieaagagihfvqeeqpetiarlldawltria