PDB entry 3wi6

View 3wi6 on RCSB PDB site
Description: Crystal structure of MAPKAP Kinase-2 (MK2) in complex with non-selective inhibitor
Class: Transferase/Transferase inhibitor
Keywords: Gly-rich loop formed, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase-Transferase inhibitor complex
Deposited on 2013-09-06, released 2013-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.242
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3wi6a_
  • Chain 'B':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3wi6b_
  • Chain 'C':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3wi6c_
  • Chain 'D':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3wi6d_
  • Chain 'E':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3wi6e_
  • Chain 'F':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3wi6f_
  • Heterogens: YRZ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wi6A (A:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wi6A (A:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdraftereaseimk
    sigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettspyyvapevlgpe
    dkscdmwslgvimyillcgyppfysispgmktrirmgqyefpnpewsevseevkmlirnl
    lkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wi6B (B:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wi6B (B:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettspyyvapevlgp
    edkscdmwslgvimyillcgyppfysispgmktrirmgqyefpnpewsevseevkmlirn
    llkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wi6C (C:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wi6C (C:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettspyyvapevlgp
    edkscdmwslgvimyillcgyppfysispgmktrirmgqyefpnpewsevseevkmlirn
    llkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wi6D (D:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wi6D (D:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdraftereaseimk
    sigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettspyyvapevlgpe
    dkscdmwslgvimyillcgyppfysispgmktrirmgqyefpnpewsevseevkmlirnl
    lkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedke
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wi6E (E:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wi6E (E:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettspyyvapevlgp
    edkscdmwslgvimyillcgyppfysispgmktrirmgqyefpnpewsevseevkmlirn
    llkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wi6F (F:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wi6F (F:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettspyyvapevlgp
    edkscdmwslgvimyillcgyppfysispgmktrirmgqyefpnpewsevseevkmlirn
    llkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedke