SCOPe 2.06: Structural Classification of Proteins

PDB entry 3whk

View 3whk on RCSB PDB site
Description: Crystal structure of PAN-Rpt5C chimera
Class: hydrolase
Keywords: Four-helix bundle, Proteasome ATPase subunit, ATP Binding, HYDROLASE
Deposited on 2013-08-26, released 2014-03-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.243
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Proteasome-activating nucleotidase, 26S protease regulatory subunit 6A
Species: Pyrococcus furiosus, Saccharomyces cerevisiae [TaxId:186497, 559292]
Gene: pan, PF0115, O3258, RPT5, YOR117W, YOR3258W, YTA1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8U4H3 (4-188)
  - expression tag (3)
- Uniprot P33297 (191-End)
  - linker (189-190)
Domains in SCOPe 2.06: d3whka1, d3whka2
Chain 'B':
Compound: Proteasome-activating nucleotidase, 26S protease regulatory subunit 6A
Species: Pyrococcus furiosus, Saccharomyces cerevisiae [TaxId:186497, 559292]
Gene: pan, PF0115, O3258, RPT5, YOR117W, YOR3258W, YTA1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8U4H3 (4-188)
  - expression tag (3)
- Uniprot P33297 (191-End)
  - linker (189-190)
Domains in SCOPe 2.06: d3whkb1, d3whkb2
Chain 'C':
Compound: Proteasome-activating nucleotidase, 26S protease regulatory subunit 6A
Species: Pyrococcus furiosus, Saccharomyces cerevisiae [TaxId:186497, 559292]
Gene: pan, PF0115, O3258, RPT5, YOR117W, YOR3258W, YTA1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8U4H3 (4-188)
  - expression tag (3)
- Uniprot P33297 (191-End)
  - linker (189-190)
Domains in SCOPe 2.06: d3whkc1, d3whkc2
Chain 'D':
Compound: Proteasome-activating nucleotidase, 26S protease regulatory subunit 6A
Species: Pyrococcus furiosus, Saccharomyces cerevisiae [TaxId:186497, 559292]
Gene: pan, PF0115, O3258, RPT5, YOR117W, YOR3258W, YTA1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8U4H3 (4-188)
  - expression tag (3)
- Uniprot P33297 (191-End)
  - linker (189-190)
Domains in SCOPe 2.06: d3whkd1, d3whkd2
Chain 'E':
Compound: Proteasome-activating nucleotidase, 26S protease regulatory subunit 6A
Species: Pyrococcus furiosus, Saccharomyces cerevisiae [TaxId:186497, 559292]
Gene: pan, PF0115, O3258, RPT5, YOR117W, YOR3258W, YTA1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8U4H3 (4-188)
  - expression tag (3)
- Uniprot P33297 (191-End)
  - linker (189-190)
Domains in SCOPe 2.06: d3whke1, d3whke2
Chain 'F':
Compound: Proteasome-activating nucleotidase, 26S protease regulatory subunit 6A
Species: Pyrococcus furiosus, Saccharomyces cerevisiae [TaxId:186497, 559292]
Gene: pan, PF0115, O3258, RPT5, YOR117W, YOR3258W, YTA1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8U4H3 (4-188)
  - expression tag (3)
- Uniprot P33297 (191-End)
  - linker (189-190)
Domains in SCOPe 2.06: d3whkf1, d3whkf2
Chain 'G':
Compound: Proteasome-activating nucleotidase, 26S protease regulatory subunit 6A
Species: Pyrococcus furiosus, Saccharomyces cerevisiae [TaxId:186497, 559292]
Gene: pan, PF0115, O3258, RPT5, YOR117W, YOR3258W, YTA1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8U4H3 (4-188)
  - expression tag (3)
- Uniprot P33297 (191-End)
  - linker (189-190)
Domains in SCOPe 2.06: d3whkg1, d3whkg2
Chain 'H':
Compound: Proteasome-activating nucleotidase, 26S protease regulatory subunit 6A
Species: Pyrococcus furiosus, Saccharomyces cerevisiae [TaxId:186497, 559292]
Gene: pan, PF0115, O3258, RPT5, YOR117W, YOR3258W, YTA1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8U4H3 (4-188)
  - expression tag (3)
- Uniprot P33297 (191-End)
  - linker (189-190)
Domains in SCOPe 2.06: d3whkh1, d3whkh2
Heterogens: ATP, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3whkA (A:)
gshmgfevverpnvtyndigglkkqlqelreaielplkhpelfeevgidppkgvllygpp
gcgktlmakaiahevnatfirvvgselvrkyigegarlvhelfelakekaptiifideid
aigakrldettggerevnrtlmqllaemdgfdprgnvkviaatnrpdildpallrpgrfd
rlievplpdefsraqilqihsrkmttdddinwqelarstdefngaqlkavtveagmialr
ngqssvkhedfvegisevqarksksvsfya