PDB entry 3wh3

View 3wh3 on RCSB PDB site
Description: human Mincle, ligand free form
Class: immune system
Keywords: c-type lectin, carbohydrate recognition, glycolipid binding, Plasmamembrane, IMMUNE SYSTEM
Deposited on 2013-08-21, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.139
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member E
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC4E
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULY5
      • engineered mutation (26)
    Domains in SCOPe 2.07: d3wh3a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wh3A (A:)
    mgsvknccplnweyfqsscyffstdtkswalslkncsamgahlvvinsqeeqeflsykkp
    kmreffiglsdqvvegqwqwvdgtpltkslsfwdvgepnniatledcatmrdssnprqnw
    ndvtcflnyfricemvginplnkgksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wh3A (A:)
    ccplnweyfqsscyffstdtkswalslkncsamgahlvvinsqeeqeflsykkpkmreff
    iglsdqvvegqwqwvdgtpltkslsfwdvgepnniatledcatmrdssnprqnwndvtcf
    lnyfricemv