PDB entry 3wfl

View 3wfl on RCSB PDB site
Description: Crtstal structure of glycoside hydrolase family 5 beta-mannanase from Talaromyces trachyspermus
Class: Hydrolase
Keywords: Tim Barrel, Hydrolase, N-linked glycosylation, Extracellular
Deposited on 2013-07-19, released 2014-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.115
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-mannanase
    Species: Talaromyces trachyspermus [TaxId:28566]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WFL (Start-341)
    Domains in SCOPe 2.06: d3wfla_
  • Heterogens: NAG, TRS, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wflA (A:)
    dtfpgtngldftidgtagyfagsnaywlafltnnddvdkvlgdaessglrimrvwgfndv
    ntvpssgtvyfqllqdgtatintgsdglerldyvvssaeqhnvkliinfvnnwsdyggip
    ayvnafggsttswytdeasqaayrnyiktvvsryidspavfawelaneprchgcdtsviy
    nwvaatssfiksidsqhlvcigdeglgldidsdgsypysyyegtnftlnlgvdtidfgtf
    hlypsswgvsnsfgspwvtahgaacaaagkpclfeeygvtsdkcsveggwqqtaldtrgi
    gadsfwqfgdtlstgqspndgytiyygtddytclvtdrvasi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wflA (A:)
    tfpgtngldftidgtagyfagsnaywlafltnnddvdkvlgdaessglrimrvwgfndvn
    tvpssgtvyfqllqdgtatintgsdglerldyvvssaeqhnvkliinfvnnwsdyggipa
    yvnafggsttswytdeasqaayrnyiktvvsryidspavfawelaneprchgcdtsviyn
    wvaatssfiksidsqhlvcigdeglgldidsdgsypysyyegtnftlnlgvdtidfgtfh
    lypsswgvsnsfgspwvtahgaacaaagkpclfeeygvtsdkcsveggwqqtaldtrgig
    adsfwqfgdtlstgqspndgytiyygtddytclvtdrvasi