PDB entry 3wfh

View 3wfh on RCSB PDB site
Description: Crystal structure of anti-Prostaglandin E2 Fab fragment PGE2 complex
Class: immune system
Keywords: immunogloblin, Anti-Prostaglandin E2 antibody, prostaglandin E2, Fab fragment by papain digestion, IMMUNE SYSTEM
Deposited on 2013-07-19, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mAb Fab H fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WFH (0-216)
  • Chain 'B':
    Compound: mAb Fab L fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WFH (0-215)
    Domains in SCOPe 2.07: d3wfhb1, d3wfhb2
  • Heterogens: P2E, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wfhB (B:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkinrveaedlgiyyclqgshvpltfgagttlelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr