PDB entry 3wfg

View 3wfg on RCSB PDB site
Description: Mineralocorticoid receptor ligand-binding domain with compuond 2e
Class: transcription/inhibitor
Keywords: NUCLEAR RECEPTOR, TRANSCRIPTION FACTOR, TRANSCRIPTION, HYPERTENSION, NON-STEROIDAL ANTAGONIST, ACTIVATING MUTATION, TRANSCRIPTION-INHIBITOR complex
Deposited on 2013-07-19, released 2013-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.165
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered mutation (98)
      • engineered mutation (100)
      • engineered mutation (266)
    Domains in SCOPe 2.06: d3wfga_
  • Heterogens: WFG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wfgA (A:)
    gsapakepsvntalvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstl
    nrlagkqmiqvvkwakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyf
    apdlvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksq
    aafeemrtnyikelrkmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfres
    halkvefpamlveiisdqlpkvesgnvkplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wfgA (A:)
    tpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlp
    ledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhq
    islqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkcpnns
    gqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesg
    nvkplyfhr