PDB entry 3web

View 3web on RCSB PDB site
Description: Crystal structure of a Niemann-Pick type C2 protein from Japanese carpenter ant in complex with oleic acid
Class: lipid binding protein
Keywords: immunoglobulin-like beta-sandwich fold, carrier protein, Oleic acid, LIPID BINDING PROTEIN
Deposited on 2013-07-02, released 2014-02-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.219
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Niemann-Pick type C2 protein
    Species: Camponotus japonicus [TaxId:84547]
    Gene: CjapNPC2
    Database cross-references and differences (RAF-indexed):
    • PDB 3WEB (0-131)
    Domains in SCOPe 2.04: d3weba_
  • Heterogens: OLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3webA (A:)
fvfedcgsevgkfsdiiisscdpseekcsiireseihvsmkftpsvdvknveakafgvll
dvpvpfplkkpeickdpdsgvkcplkkdveieykvtffvekatpalsleimwefrnekde
kitcvkfpakik