PDB entry 3we6

View 3we6 on RCSB PDB site
Description: Crystal structure of anti-Prostaglandin E2 Fab fragment
Class: immune system
Keywords: immunogloblin, Anti-Prostaglandin E2 antibody, Prostaglandin E2, IMMUNE SYSTEM
Deposited on 2013-07-01, released 2014-07-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mAb Fab H fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WE6 (Start-217)
  • Chain 'B':
    Compound: mAb Fab L fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WE6 (0-216)
    Domains in SCOPe 2.06: d3we6b1, d3we6b2
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3we6B (B:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkinrveaedlgiyyclqgshvpltfgagttlelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn