PDB entry 3we1

View 3we1 on RCSB PDB site
Description: Crystal structure of Dengue 4 Envelope protein domain III (ED3)
Class: Structural protein, Immune system
Keywords: Immunoglobulin like domain, cell surface receptor binding, represent epitope, virus surface, Structural protein, Immune system
Deposited on 2013-06-27, released 2014-01-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.267
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Dengue virus type 4 [TaxId:408871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3we1a_
  • Chain 'B':
    Compound: Envelope protein E
    Species: Dengue virus type 4 [TaxId:408871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3we1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3we1A (A:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgnsaltlhwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3we1A (A:)
    sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
    aentnsvtnieleppfgdsyivigvgnsaltlhwfrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3we1B (B:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgnsaltlhwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3we1B (B:)
    sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
    aentnsvtnieleppfgdsyivigvgnsaltlhwfrk