PDB entry 3wd9

View 3wd9 on RCSB PDB site
Description: Crystal structure of phosphodiesterase 4B in complex with compound 10f
Class: hydrolase/hydrolase inhibitor
Keywords: phosphodiesterase, COPD, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-06-11, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wd9a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wd9b_
  • Heterogens: QPC, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wd9A (A:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqfelt
    ldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd9A (A:)
    srfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfriss
    dtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaai
    hdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqt
    lrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadl
    snptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhp
    lwetwadlvqpdaqdildtlednrnwyqsmipcqglmekfqfelt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wd9B (B:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqfelt
    ldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd9B (B:)
    srfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfriss
    dtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaai
    hdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqt
    lrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadl
    snptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhp
    lwetwadlvqpdaqdildtlednrnwyqsmipcqglmekfqfelt