PDB entry 3wd8

View 3wd8 on RCSB PDB site
Description: TypeIII polyketide synthases
Class: transferase
Keywords: quinolone synthase, Type III polyketide synthase, Acyltransferase, TRANSFERASE
Deposited on 2013-06-10, released 2013-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type III polyketide synthase quinolone synthase
    Species: Citrus microcarpa [TaxId:164113]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WD8
    Domains in SCOPe 2.06: d3wd8a1, d3wd8a2, d3wd8a3
  • Chain 'B':
    Compound: Type III polyketide synthase quinolone synthase
    Species: Citrus microcarpa [TaxId:164113]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WD8
    Domains in SCOPe 2.06: d3wd8b1, d3wd8b2, d3wd8b3
  • Chain 'C':
    Compound: Type III polyketide synthase quinolone synthase
    Species: Citrus microcarpa [TaxId:164113]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WD8
    Domains in SCOPe 2.06: d3wd8c1, d3wd8c2, d3wd8c3
  • Chain 'D':
    Compound: Type III polyketide synthase quinolone synthase
    Species: Citrus microcarpa [TaxId:164113]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WD8
    Domains in SCOPe 2.06: d3wd8d1, d3wd8d2, d3wd8d3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wd8A (A:)
    mrgshhhhhhgsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdceh
    ktelkdkfkricdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgke
    aaakaikewgqplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfigg
    aaircakdfaennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadp
    evsierplfhvvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavs
    pfgisdwnslfysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfilde
    irkksmqeakpttgdglewgvlfaigpgltvetvillsvpidsac
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd8A (A:)
    gsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdcehktelkdkfkr
    icdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgkeaaakaikewg
    qplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfiggaaircakdfa
    ennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadpevsierplfh
    vvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavspfgisdwnsl
    fysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfildeirkksmqeak
    pttgdglewgvlfaigpgltvetvillsvpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wd8B (B:)
    mrgshhhhhhgsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdceh
    ktelkdkfkricdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgke
    aaakaikewgqplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfigg
    aaircakdfaennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadp
    evsierplfhvvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavs
    pfgisdwnslfysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfilde
    irkksmqeakpttgdglewgvlfaigpgltvetvillsvpidsac
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd8B (B:)
    gsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdcehktelkdkfkr
    icdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgkeaaakaikewg
    qplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfiggaaircakdfa
    ennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadpevsierplfh
    vvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavspfgisdwnsl
    fysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfildeirkksmqeak
    pttgdglewgvlfaigpgltvetvillsvpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wd8C (C:)
    mrgshhhhhhgsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdceh
    ktelkdkfkricdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgke
    aaakaikewgqplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfigg
    aaircakdfaennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadp
    evsierplfhvvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavs
    pfgisdwnslfysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfilde
    irkksmqeakpttgdglewgvlfaigpgltvetvillsvpidsac
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd8C (C:)
    gsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdcehktelkdkfkr
    icdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgkeaaakaikewg
    qplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfiggaaircakdfa
    ennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadpevsierplfh
    vvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavspfgisdwnsl
    fysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfildeirkksmqeak
    pttgdglewgvlfaigpgltvetvillsvpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wd8D (D:)
    mrgshhhhhhgsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdceh
    ktelkdkfkricdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgke
    aaakaikewgqplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfigg
    aaircakdfaennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadp
    evsierplfhvvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavs
    pfgisdwnslfysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfilde
    irkksmqeakpttgdglewgvlfaigpgltvetvillsvpidsac
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd8D (D:)
    gsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdcehktelkdkfkr
    icdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgkeaaakaikewg
    qplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfiggaaircakdfa
    ennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadpevsierplfh
    vvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavspfgisdwnsl
    fysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfildeirkksmqeak
    pttgdglewgvlfaigpgltvetvillsvpi