PDB entry 3wd7

View 3wd7 on RCSB PDB site
Description: Type III polyketide synthase
Class: transferase
Keywords: acridone synthase, Type III polyketide synthase, acyltransferase, TRANSFERASE
Deposited on 2013-06-10, released 2013-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type III polyketide synthases acridone synthase
    Species: Citrus microcarpa [TaxId:164113]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WD7 (0-End)
    Domains in SCOPe 2.06: d3wd7a1, d3wd7a2, d3wd7a3
  • Chain 'B':
    Compound: Type III polyketide synthases acridone synthase
    Species: Citrus microcarpa [TaxId:164113]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WD7 (0-End)
    Domains in SCOPe 2.06: d3wd7b1, d3wd7b2, d3wd7b3
  • Heterogens: COA, NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wd7A (A:)
    mrgshhhhhhgsmvtmeeirrakraeglatilaistatppncviqadypdyyfgitnseh
    mtelkekfkllceksmirkrhmclteeilkanpnmclymgtsldarqdislvevpklgke
    aatkaikewgqpksnithlifctsagvdmpgadyqltrliglnpdvkrmmiyqqgcyaga
    tilrlakdlaennkgsrvlvvcsentiptfrgpsythidslvgqalfadgaaalivgadp
    dtsierplyhivsasqtllpdsdgaieghireagltvhlkkdvpeffsaniekslvdaft
    pigisdwnsifwiahpggpaildqveaklglkkdklrasrhvmseygnmssacvlfilde
    mrnkcleegkattgegldwgvlfgfgpgltvetvvlhslpiea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd7A (A:)
    mrgshhhhhhgsmvtmeeirrakraeglatilaistatppncviqadypdyyfgitnseh
    mtelkekfkllceksmirkrhmclteeilkanpnmclymgtsldarqdislvevpklgke
    aatkaikewgqpksnithlifctsagvdmpgadyqltrliglnpdvkrmmiyqqgcyaga
    tilrlakdlaennkgsrvlvvcsentiptfrgpsythidslvgqalfadgaaalivgadp
    dtsierplyhivsasqtllpdsdgaieghireagltvhlkkdvpeffsaniekslvdaft
    pigisdwnsifwiahpggpaildqveaklglkkdklrasrhvmseygnmssacvlfilde
    mrnkcleegkattgegldwgvlfgfgpgltvetvvlhslpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wd7B (B:)
    mrgshhhhhhgsmvtmeeirrakraeglatilaistatppncviqadypdyyfgitnseh
    mtelkekfkllceksmirkrhmclteeilkanpnmclymgtsldarqdislvevpklgke
    aatkaikewgqpksnithlifctsagvdmpgadyqltrliglnpdvkrmmiyqqgcyaga
    tilrlakdlaennkgsrvlvvcsentiptfrgpsythidslvgqalfadgaaalivgadp
    dtsierplyhivsasqtllpdsdgaieghireagltvhlkkdvpeffsaniekslvdaft
    pigisdwnsifwiahpggpaildqveaklglkkdklrasrhvmseygnmssacvlfilde
    mrnkcleegkattgegldwgvlfgfgpgltvetvvlhslpiea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd7B (B:)
    mrgshhhhhhgsmvtmeeirrakraeglatilaistatppncviqadypdyyfgitnseh
    mtelkekfkllceksmirkrhmclteeilkanpnmclymgtsldarqdislvevpklgke
    aatkaikewgqpksnithlifctsagvdmpgadyqltrliglnpdvkrmmiyqqgcyaga
    tilrlakdlaennkgsrvlvvcsentiptfrgpsythidslvgqalfadgaaalivgadp
    dtsierplyhivsasqtllpdsdgaieghireagltvhlkkdvpeffsaniekslvdaft
    pigisdwnsifwiahpggpaildqveaklglkkdklrasrhvmseygnmssacvlfilde
    mrnkcleegkattgegldwgvlfgfgpgltvetvvlhslpi