PDB entry 3wd5

View 3wd5 on RCSB PDB site
Description: Crystal structure of TNFalpha in complex with Adalimumab Fab fragment
Class: immune system
Keywords: Antibody binding epitope, IMMUNE SYSTEM
Deposited on 2013-06-06, released 2013-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • conflict (30)
    Domains in SCOPe 2.07: d3wd5a_
  • Chain 'H':
    Compound: Adalimumab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WD5 (0-218)
  • Chain 'L':
    Compound: Adalimumab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WD5 (0-212)
    Domains in SCOPe 2.07: d3wd5l1, d3wd5l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wd5A (A:)
    vrsssrtpsdkpvahvvanpqaegqlqwlndranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd5A (A:)
    rtpsdkpvahvvanpqaegqlqwlndranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wd5L (L:)
    diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge