PDB entry 3wcx

View 3wcx on RCSB PDB site
Description: Crystal Structure of Sphingomyelinase C from Streptomyces griseocarneus
Class: hydrolase
Keywords: DNase I-like fold, HYDROLASE
Deposited on 2013-06-03, released 2014-06-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sphingomyelinase c
    Species: Streptomyces griseocarneus [TaxId:51201]
    Gene: SMC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wcxa_
  • Heterogens: EPE, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wcxA (A:)
    sapaaatpslkvltyntflmstglypnwgqehrareiaaagffqgndvvvlqeafdnaaa
    dglkaaaadrypyqtpvvgrsrdgwdatggkysattpedggvtvlskwpivrkeqvifnd
    acgadwwsnkgfayvvlnvggtrvhvvgthaqstdsgcaageaaadrsrqfrqidaflda
    knipadeqvmlagdlnvdshsaeyasmladgdlapadsraghpysfdtkensiaayrypt
    dpredldyvlhrngharpagwrntvvqetsapwtvsswgkrytytdlsghypviagan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wcxA (A:)
    tpslkvltyntflmstglypnwgqehrareiaaagffqgndvvvlqeafdnaaadglkaa
    aadrypyqtpvvgrsrdgwdatggkysattpedggvtvlskwpivrkeqvifndacgadw
    wsnkgfayvvlnvggtrvhvvgthaqstdsgcaageaaadrsrqfrqidafldaknipad
    eqvmlagdlnvdshsaeyasmladgdlapadsraghpysfdtkensiaayryptdpredl
    dyvlhrngharpagwrntvvqetsapwtvsswkrytytdlsghypviagan