PDB entry 3wbr

View 3wbr on RCSB PDB site
Description: Crystal structure of carbohydrate recognition domain of Blood Dendritic Cell Antigen-2 (BDCA2) lectin (crystal form-3)
Class: Carbohydrate Binding Protein
Keywords: C-type lectin fold, immune receptor, complex-type N-glycan, Carbohydrate Binding Protein
Deposited on 2013-05-20, released 2013-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.255
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTT0 (2-129)
      • expression tag (1)
    Domains in SCOPe 2.06: d3wbra1, d3wbra2
  • Chain 'B':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTT0 (2-129)
      • expression tag (1)
    Domains in SCOPe 2.06: d3wbrb1, d3wbrb2
  • Chain 'C':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTT0 (2-129)
      • expression tag (1)
    Domains in SCOPe 2.06: d3wbrc1, d3wbrc2
  • Chain 'D':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wbrd_
  • Chain 'E':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wbre_
  • Chain 'F':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wbrf_
  • Chain 'G':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wbrg_
  • Chain 'H':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wbrh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wbrA (A:)
    gscptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssy
    flglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchv
    pqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbrA (A:)
    scptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyf
    lglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrseewgwndihchvpq
    ksickmkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wbrB (B:)
    gscptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssy
    flglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchv
    pqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbrB (B:)
    scptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyf
    lglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrseewgwndihchvpq
    ksickmkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wbrC (C:)
    gscptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssy
    flglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchv
    pqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbrC (C:)
    scptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyf
    lglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsewgwndihchvpqk
    sickmkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wbrD (D:)
    gscptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssy
    flglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchv
    pqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbrD (D:)
    cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
    glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsewgwndihchvpqks
    ickmkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wbrE (E:)
    gscptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssy
    flglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchv
    pqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbrE (E:)
    cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
    glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrssewgwndihchvpqk
    sickm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wbrF (F:)
    gscptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssy
    flglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchv
    pqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbrF (F:)
    cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
    glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrssewgwndihchvpqk
    sickmkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wbrG (G:)
    gscptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssy
    flglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchv
    pqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbrG (G:)
    cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
    glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchvpq
    ksickmk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3wbrH (H:)
    gscptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssy
    flglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchv
    pqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbrH (H:)
    cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
    glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrssewgwndihchvpqk
    sickmk