PDB entry 3wbp

View 3wbp on RCSB PDB site
Description: Crystal structure of carbohydrate recognition domain of Blood Dendritic Cell Antigen-2 (BDCA2) lectin (crystal form-1)
Class: Carbohydrate Binding Protein
Keywords: C-type lectin fold, immune receptor, complex-type N-glycan, Carbohydrate Binding Protein
Deposited on 2013-05-20, released 2013-12-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.255
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTT0 (25-152)
      • expression tag (24)
    Domains in SCOPe 2.03: d3wbpa_
  • Chain 'B':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: BDCA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTT0 (25-152)
      • expression tag (24)
    Domains in SCOPe 2.03: d3wbpb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wbpA (A:)
    mnhkvhhhhhhiegrhmenlyfqgscptpwtsfqsscyfistgmqswtksqkncsvmgad
    lvvintreeqdfiiqnlkrnssyflglsdpggrrhwqwvdqtpynenvtfwhsgepnnld
    ercaiinfrsseewgwndihchvpqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbpA (A:)
    scptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyf
    lglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrssewgwndihchvpq
    ksickmkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wbpB (B:)
    mnhkvhhhhhhiegrhmenlyfqgscptpwtsfqsscyfistgmqswtksqkncsvmgad
    lvvintreeqdfiiqnlkrnssyflglsdpggrrhwqwvdqtpynenvtfwhsgepnnld
    ercaiinfrsseewgwndihchvpqksickmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbpB (B:)
    scptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyf
    lglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsewgwndihchvpqk
    sickmkk