PDB entry 3wbg

View 3wbg on RCSB PDB site
Description: Structure of the human heart fatty acid-binding protein in complex with 1-anilinonaphtalene-8-sulphonic acid
Class: lipid binding protein
Keywords: beta barrel, LIPID BINDING PROTEIN
Deposited on 2013-05-16, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wbga_
  • Chain 'B':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wbgb_
  • Chain 'C':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wbgc_
  • Chain 'D':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wbgd_
  • Heterogens: 2AN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wbgA (A:)
    mgsshhhhhhssglvprgshmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpt
    tiiekngdiltlkthstfknteisfklgvefdettaddrkvksivtldggklvhlqkwdg
    qettlvrelidgkliltlthgtavctrtyekea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbgA (A:)
    mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyeke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wbgB (B:)
    mgsshhhhhhssglvprgshmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpt
    tiiekngdiltlkthstfknteisfklgvefdettaddrkvksivtldggklvhlqkwdg
    qettlvrelidgkliltlthgtavctrtyekea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbgB (B:)
    mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyeke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wbgC (C:)
    mgsshhhhhhssglvprgshmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpt
    tiiekngdiltlkthstfknteisfklgvefdettaddrkvksivtldggklvhlqkwdg
    qettlvrelidgkliltlthgtavctrtyekea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbgC (C:)
    mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyeke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wbgD (D:)
    mgsshhhhhhssglvprgshmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpt
    tiiekngdiltlkthstfknteisfklgvefdettaddrkvksivtldggklvhlqkwdg
    qettlvrelidgkliltlthgtavctrtyekea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbgD (D:)
    mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyeke