PDB entry 3wba

View 3wba on RCSB PDB site
Description: Rice Os3BGlu6 E178Q with Covalent Glucosyl Moiety from p-nitrophenyl glucopyranoside.
Class: hydrolase
Keywords: TIM BARREL, Beta-glucosidase, Covalently bound to Glucose, Secreted, HYDROLASE
Deposited on 2013-05-14, released 2013-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.148
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase 6
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: BGLU6, LOC_Os03g11420, Os03g0212800
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L7J2 (Start-488)
      • engineered mutation (178)
    Domains in SCOPe 2.06: d3wbaa_
  • Heterogens: GLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wbaA (A:)
    gfstmaqqsgggltrgsfpegfvfgtasaayqyegavkedgrgqtiwdtfahtfgkitdf
    snadvavdqyhrfeediqlmadmgmdayrfsiawsriypngvgqvnqagidhynklidal
    lakgiqpyvtlyhwdlpqaledkykgwldrqivddfaayaetcfrefgdrvkhwitlnqp
    htvaiqgydaglqapgrcsvllhlyckagnsgtepyvvahhfilahaaaasiyrtkykat
    qngqlgiafdvmwfepmsnttidieaakraqefqlgwfadpfffgdypatmrarvgerlp
    rftadeaavvkgaldfvginhyttyytrhnntniigtllnntladtgtvslpfkngkpig
    dransiwlyivprgmrslmnyvkerynsppvyitengmddsnnpfisikdalkdskriky
    hndyltnlaasikedgcdvrgyfawslldnwewaagyssrfglyfvdykdnlkrypknsv
    qwfkallkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbaA (A:)
    gltrgsfpegfvfgtasaayqyegavkedgrgqtiwdtfahtfgkitdfsnadvavdqyh
    rfeediqlmadmgmdayrfsiawsriypngvgqvnqagidhynklidallakgiqpyvtl
    yhwdlpqaledkykgwldrqivddfaayaetcfrefgdrvkhwitlnqphtvaiqgydag
    lqapgrcsvllhlyckagnsgtepyvvahhfilahaaaasiyrtkykatqngqlgiafdv
    mwfepmsnttidieaakraqefqlgwfadpfffgdypatmrarvgerlprftadeaavvk
    galdfvginhyttyytrhnntniigtllnntladtgtvslpfkngkpigdransiwlyiv
    prgmrslmnyvkerynsppvyitengmddsnnpfisikdalkdskrikyhndyltnlaas
    ikedgcdvrgyfawslldnwewaagyssrfglyfvdykdnlkrypknsvqwfkallkt