PDB entry 3wa0
View 3wa0 on RCSB PDB site
Description: Crystal structure of merlin complexed with DCAF1/VprBP
Class: cell adhesion
Keywords: merlin FERM domain, CELL ADHESION
Deposited on
2013-04-20, released
2014-05-28
The last revision prior to the SCOPe 2.04 freeze date was dated
2014-06-25, with a file datestamp of
2014-06-20.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.237
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: merlin
Species: Mus musculus [TaxId:10090]
Gene: Nf2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3wa0a1, d3wa0a2, d3wa0a3 - Chain 'B':
Compound: merlin
Species: Mus musculus [TaxId:10090]
Gene: Nf2
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: merlin
Species: Mus musculus [TaxId:10090]
Gene: Nf2
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: merlin
Species: Mus musculus [TaxId:10090]
Gene: Nf2
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: merlin
Species: Mus musculus [TaxId:10090]
Gene: Nf2
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: merlin
Species: Mus musculus [TaxId:10090]
Gene: Nf2
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: protein vprbp
Species: Homo sapiens [TaxId:9606]
Gene: DCAF1
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: protein vprbp
Species: Homo sapiens [TaxId:9606]
Gene: DCAF1
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: protein vprbp
Species: Homo sapiens [TaxId:9606]
Gene: DCAF1
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: protein vprbp
Species: Homo sapiens [TaxId:9606]
Gene: DCAF1
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: protein vprbp
Species: Homo sapiens [TaxId:9606]
Gene: DCAF1
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3wa0A (A:)
gplgspktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtva
wlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvyc
ppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawya
ehrgrardeaemeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpk
isfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrka
d
Sequence, based on observed residues (ATOM records): (download)
>3wa0A (A:)
vrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdkkvld
hdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvycppeasvllas
yavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgrardea
emeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirn
isysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.