PDB entry 3wa0

View 3wa0 on RCSB PDB site
Description: Crystal structure of merlin complexed with DCAF1/VprBP
Class: cell adhesion
Keywords: merlin FERM domain, CELL ADHESION
Deposited on 2013-04-20, released 2014-05-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.237
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3wa0a1, d3wa0a2, d3wa0a3
  • Chain 'B':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: protein vprbp
    Species: Homo sapiens [TaxId:9606]
    Gene: DCAF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: protein vprbp
    Species: Homo sapiens [TaxId:9606]
    Gene: DCAF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: protein vprbp
    Species: Homo sapiens [TaxId:9606]
    Gene: DCAF1
    Database cross-references and differences (RAF-indexed):
    • PDB 3WA0 (0-6)
  • Chain 'J':
    Compound: protein vprbp
    Species: Homo sapiens [TaxId:9606]
    Gene: DCAF1
    Database cross-references and differences (RAF-indexed):
    • PDB 3WA0 (0-7)
  • Chain 'K':
    Compound: protein vprbp
    Species: Homo sapiens [TaxId:9606]
    Gene: DCAF1
    Database cross-references and differences (RAF-indexed):
    • PDB 3WA0 (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wa0A (A:)
    gplgspktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtva
    wlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvyc
    ppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawya
    ehrgrardeaemeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpk
    isfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrka
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wa0A (A:)
    vrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdkkvld
    hdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvycppeasvllas
    yavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgrardea
    emeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirn
    isysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.