PDB entry 3w9y

View 3w9y on RCSB PDB site
Description: Crystal structure of the human DLG1 guanylate kinase domain
Class: peptide binding protein
Keywords: guanylate kinase, molecular scaffold, peptide binding, cell membrane, PEPTIDE BINDING PROTEIN
Deposited on 2013-04-18, released 2013-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w9ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w9yA (A:)
    gssgssgnytrpviilgpmkdrinddlisefpdkfgscvphttrpkrdyevdgrdyhfvt
    sreqmekdiqehkfieagqynnhlygtsvqsvrevaekgkhcildvsgnaikrlqiaqly
    pisifikpksmenimemnkrlteeqarktferamkleqeftehftaivqgdtlediynqv
    kqiieeqsgsyiwvpakekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w9yA (A:)
    nytrpviilgpmkdrinddlisefpdkfgscvphttrpkrdyevdgrdyhfvtsreqmek
    diqehkfieagqynnhlygtsvqsvrevaekgkhcildvsgnaikrlqiaqlypisifik
    pksmferamkleqeftehftaivqgdtlediynqvkqiieeqsgsyiwvpakekl