PDB entry 3w9u

View 3w9u on RCSB PDB site
Description: Crystal structure of Lipk107
Class: hydrolase
Keywords: Lipase, HYDROLASE
Deposited on 2013-04-17, released 2013-12-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative lipase
    Species: Proteus mirabilis [TaxId:529507]
    Gene: PMI0999
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3w9ua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w9uA (A:)
    gshmstkypivlvhglagfneivgfpyfygiadalrqdghqvftaslsafnsnevrgkql
    wqfvqtllqetqakkvnfighsqgplacryvaanypdsvasvtsingvnhgseiadlyrr
    imrkdsipeyivekvlnafgtiistfsghrgdpqdaiaalesltteqvtefnnkypqalp
    ktpggegdeivngvhyycfgsyiqgliagekgnlldpthaamrvlntfftekqndglvgr
    ssmrlgklikddyaqdhidmvnqvaglvgynedivaiytqhakylaskql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w9uA (A:)
    stkypivlvhglagfneivgfpyfygiadalrqdghqvftaslsafnsnevrgkqlwqfv
    qtllqetqakkvnfighsqgplacryvaanypdsvasvtsingvnhgseiadlyrrimrk
    dsipeyivekvlnafgtiistfsgdaiaalesltteqvtefnnkypqalpktpggegdei
    vngvhyycfgsyiqglnlldpthaamrvlntfftekqndglvgrssmrlgklikddyaqd
    hidmvnqvaglvgynedivaiytqhakylaskql