PDB entry 3w9s

View 3w9s on RCSB PDB site
Description: Crystal Structure Analysis of the N-terminal Receiver domain of Response Regulator PmrA
Class: signaling protein/antimicrobial protein
Keywords: alpha and beta proteins, Rossmann fold topology, polymyxin b resistant protein A, response regulator, SIGNALING PROTEIN-ANTIMICROBIAL PROTEIN complex
Deposited on 2013-04-15, released 2013-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: OmpR family response regulator in two-component regulatory system with BasS
    Species: Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 [TaxId:484021]
    Gene: KP1_1760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w9sa_
  • Chain 'B':
    Compound: OmpR family response regulator in two-component regulatory system with BasS
    Species: Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 [TaxId:484021]
    Gene: KP1_1760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w9sb_
  • Heterogens: BEF, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w9sA (A:)
    mkilvieddalllqglilamqsegyvcdgvstaheaalslasnhyslivldlglpdedgl
    hflsrmrrekmtqpvliltardtledrisgldtgaddylvkpfaleelnarirallrrhn
    nqglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w9sA (A:)
    kilvieddalllqglilamqsegyvcdgvstaheaalslasnhyslivldlglpdedglh
    flsrmrrekmtqpvliltardtledrisgldtgaddylvkpfaleelnarirallr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w9sB (B:)
    mkilvieddalllqglilamqsegyvcdgvstaheaalslasnhyslivldlglpdedgl
    hflsrmrrekmtqpvliltardtledrisgldtgaddylvkpfaleelnarirallrrhn
    nqglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w9sB (B:)
    kilvieddalllqglilamqsegyvcdgvstaheaalslasnhyslivldlglpdedglh
    flsrmrrekmtqpvliltardtledrisgldtgaddylvkpfaleelnarirallrr