PDB entry 3w5j

View 3w5j on RCSB PDB site
Description: Crystal structure of GDP-bound NfeoB from Gallionella capsiferriformans
Class: metal transport
Keywords: g protein, iron transport, gtpase, transmembrane, GDP, metal transport
Deposited on 2013-01-30, released 2013-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrous iron transport protein B
    Species: Gallionella capsiferriformans [TaxId:395494]
    Gene: Galf_2203
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9SIP4 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3w5ja1, d3w5ja2
  • Chain 'B':
    Compound: Ferrous iron transport protein B
    Species: Gallionella capsiferriformans [TaxId:395494]
    Gene: Galf_2203
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9SIP4 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3w5jb1, d3w5jb2
  • Heterogens: GDP, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w5jA (A:)
    gqfkriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgi
    ydlhgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsde
    akqygitidsrkmsellqipvfqlsgkygtgyqealqavtralryptpgmaenvrtqleq
    dehieaemvrilksavqiparlpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5jA (A:)
    qfkriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiy
    dlhgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdea
    kqygitidsrkmsellqipvfqlstgyqealqavtralryptpgmaenvrtqleqdehie
    aemvrilksavqip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w5jB (B:)
    gqfkriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgi
    ydlhgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsde
    akqygitidsrkmsellqipvfqlsgkygtgyqealqavtralryptpgmaenvrtqleq
    dehieaemvrilksavqiparlpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5jB (B:)
    fkriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiyd
    lhgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdeak
    qygitidsrkmsellqipvfqlstgyqealqavtralryptpgmaenvrtqleqdehiea
    emvrilksavqip