PDB entry 3w5e

View 3w5e on RCSB PDB site
Description: Crystal structure of phosphodiesterase 4B in complex with compound 31e
Class: hydrolase/hydrolase inhibitor
Keywords: phosphodiesterase, COPD, inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-01-28, released 2013-05-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3w5ea_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3w5eb_
  • Heterogens: NVW, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w5eA (A:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqfelt
    ldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5eA (A:)
    srfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfriss
    dtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaai
    hdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqt
    lrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadl
    snptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhp
    lwetwadlvqpdaqdildtlednrnwyqsmipcqglmekfqfelt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w5eB (B:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqfelt
    ldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5eB (B:)
    srfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfriss
    dtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaai
    hdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqt
    lrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadl
    snptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhp
    lwetwadlvqpdaqdildtlednrnwyqsmipcqglmekfqfelt