PDB entry 3w53

View 3w53 on RCSB PDB site
Description: Crystal structure of psychrophilic beta-glucosidase BglU from Micrococcus antarcticus
Class: hydrolase
Keywords: TIM barrel, beta-glucosidase, HYDROLASE
Deposited on 2013-01-18, released 2014-01-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.163
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Micrococcus antarcticus [TaxId:86171]
    Gene: BglU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3w53a_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w53A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmmnhlsqkfawpkeflwgsataaaqi
    egaghsygkedsvwdafarkegaiaggenlevavdhyhryredvqlmrelgldsyrfsts
    warvvpggrtvnpegldfysrlvdellengilpwltlyhwdlpqaleerggwtnretsyk
    fleyaetvheklgdrvkhwttfneplcssligyaagehapgrqepqaalaavhhqhlahg
    latarlrelgaehigitlnltnavpnnpgdpvdleaarrvdalwnrmyldpvlrgsyped
    lledvqglglaevieagdleiisqpidflgvnhyhddnvsghplpagqpqpvvptdspks
    spfvgseyvtfpardlprtamgwevnpeglrvllnrlnqdyanlpslyitengasytdtv
    teagtvedpereeyilnhldavvraiadgvdvrgyfvwslldnfewawgyakrfgiihvd
    yqtqvrtiknsgkayagliaanrtma
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w53A (A:)
    mnhlsqkfawpkeflwgsataaaqiegaghsygkedsvwdafarkegaiaggenlevavd
    hyhryredvqlmrelgldsyrfstswarvvpggrtvnpegldfysrlvdellengilpwl
    tlyhwdlpqaleerggwtnretsykfleyaetvheklgdrvkhwttfneplcssligyaa
    gehapgrqepqaalaavhhqhlahglatarlrelgaehigitlnltnavpnnpgdpvdle
    aarrvdalwnrmyldpvlrgsypedlledvqglglaevieagdleiisqpidflgvnhyh
    ddnvsghplpagqpqpvvptdspksspfvgseyvtfpardlprtamgwevnpeglrvlln
    rlnqdyanlpslyitengasytdtvteagtvedpereeyilnhldavvraiadgvdvrgy
    fvwslldnfewawgyakrfgiihvdyqtqvrtiknsgkayagliaanrt