PDB entry 3w3z

View 3w3z on RCSB PDB site
Description: Crystal structure of Kap121p bound to RanGTP
Class: protein transport/nuclear protein
Keywords: HEAT repeat, nuclear import, PROTEIN TRANSPORT-NUCLEAR PROTEIN complex
Deposited on 2012-12-28, released 2013-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.262
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit beta-3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PSE1, KAP121, YMR308C, YM9952.10C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GTP-binding nuclear protein ran
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: RAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3w3zb_
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3w3zB (B:)
maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlef

    Sequence, based on observed residues (ATOM records): (download) 
    >3w3zB (B:)
epqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwd
tagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlef