PDB entry 3w3e

View 3w3e on RCSB PDB site
Description: Structure of Vigna unguiculata chitinase with regulation activity of the plant cell wall
Class: hydrolase
Keywords: alpha helical protein, Hydrolase, Family 19 glycosidase, Regulatory protein of the cell wall yield threshold, cotyledon
Deposited on 2012-12-20, released 2013-01-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.204
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cotyledoneous yieldin-like protein
    Species: Vigna unguiculata [TaxId:3917]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3w3ea_
  • Chain 'B':
    Compound: Cotyledoneous yieldin-like protein
    Species: Vigna unguiculata [TaxId:3917]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w3eA (A:)
    aevgsvigaslfdqllkhrndqacegkgfysynafitaarsfaafgttgdsntrkrevaa
    flaqtshettggaatspdgpyawgycfvterdksnrycdgsgpcsagksyygrgpiqlth
    nynynaagralgvdlinnpdlvardavvsfktalwfwmtpqgnkpschdvitnrwtpsaa
    dkaanrvpgfgvitniingglecgkgptpasgdrigfykrycdvfgvsygpnlncrdqrp
    fg
    

  • Chain 'B':
    No sequence available.