PDB entry 3w2y

View 3w2y on RCSB PDB site
Description: Crystal structure of DNA uridine endonuclease Mth212 mutant W205S
Class: hydrolase
Keywords: alpha/beta-sandwich, Hydrolase, DNA binding
Deposited on 2012-12-06, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: MTH212, MTH_212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26314 (Start-259)
      • engineered mutation (207)
    Domains in SCOPe 2.07: d3w2ya_
  • Chain 'D':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: MTH212, MTH_212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26314 (Start-259)
      • engineered mutation (207)
    Domains in SCOPe 2.07: d3w2yd_
  • Heterogens: MG, FMT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w2yA (A:)
    gshmtvlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyr
    sfftpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkm
    seerlkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpve
    rawidkfiengyvdtfrmfnsdpgqytswsyrtrarernvgwrldyffvneefkgkvkrs
    wilsdvmgsdhcpigleiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w2yA (A:)
    tvlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
    paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
    lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
    dkfiengyvdtfrmfnsdpgqytswsyrtrarernvgwrldyffvneefkgkvkrswils
    dvmgsdhcpigleiel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3w2yD (D:)
    gshmtvlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyr
    sfftpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkm
    seerlkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpve
    rawidkfiengyvdtfrmfnsdpgqytswsyrtrarernvgwrldyffvneefkgkvkrs
    wilsdvmgsdhcpigleiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w2yD (D:)
    tvlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
    paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
    lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
    dkfiengyvdtfrmfnsdpgqytswsyrtrarernvgwrldyffvneefkgkvkrswils
    dvmgsdhcpigleiel