PDB entry 3w2e

View 3w2e on RCSB PDB site
Description: Crystal structure of oxidation intermediate (20 min) of NADH-cytochrome b5 reductase from pig liver
Class: oxidoreductase
Keywords: Reductase, cytochrome b5, OXIDOREDUCTASE
Deposited on 2012-11-28, released 2013-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH-cytochrome b5 reductase 3
    Species: Sus scrofa [TaxId:9823]
    Gene: CYB5R3, DIA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3w2ea1, d3w2ea2
  • Heterogens: FAD, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w2eA (A:)
    tpaitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnlv
    irpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngllv
    yqgkgkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfan
    qtekdillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeepl
    vlmcgpppmiqyaclpnlervghpkercfaf