PDB entry 3w2c

View 3w2c on RCSB PDB site
Description: Structure of Aurora kinase A complexed to benzoimidazole-indazole inhibitor XV
Class: transferase
Keywords: kinase, ATP competitor, TRANSFERASE
Deposited on 2012-11-28, released 2014-02-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.256
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3w2ce_
  • Chain 'G':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3w2cg_
  • Heterogens: N15, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3w2cE (E:)
    waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
    hskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmhd
    ekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhn
    psqrpmlrevlehpwitanss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w2cE (E:)
    waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqeveiqshlrhpnilrlygy
    fhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyckpenlllgsage
    lkiadtldylppemievdlwslgvlcyeflvgkppfeantyqykrisrveftfpdfvteg
    ardlisrllkhnphpwitanss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3w2cG (G:)
    waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
    hskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmhd
    ekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhn
    psqrpmlrevlehpwitanss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w2cG (G:)
    waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqeveiqshlrhpnilrlygy
    fhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyckpenlllgsage
    lkiadtldylppemievdlwslgvlcyeflvgkppfeantyqykrisrveftfpdfvteg
    ardlisrllkhnphpwitanss