PDB entry 3w29

View 3w29 on RCSB PDB site
Description: The high-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E251A mutant with xylotetraose
Class: hydrolase
Keywords: glycoside hydrolase, xylanase, thermophilic, xylotetraose, HYDROLASE
Deposited on 2012-11-27, released 2013-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.183
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 10
    Species: Thermoanaerobacterium saccharolyticum [TaxId:1094508]
    Gene: Tsac_1459
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3VVC1 (0-End)
      • engineered mutation (250)
    Domains in SCOPe 2.06: d3w29a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w29A (A:)
    tiqndipdlysvfkdyfpigvavdpsrlndadphaqltakhfnmlvaenamkpeslqpte
    gnftfdnadkivdyaiahnmkmrghtllwhnqvpdwffqdpsdpskpasrdlllqrlrth
    ittvldhfktkygsqnpiigwdvvnevlddngnlrnskwlqiigpdyiekafeyaheadp
    smklfindynienngvktqamydlvkklknegvpingigmqmhisinsnidnikasiekl
    aslgveiqvtaldmnmngdvsndallkqarlykqlfdlfkaekqyitavvfwgvsddvsw
    lskpnapllfdsklqakpaywaivdlgkaipdiqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w29A (A:)
    tiqndipdlysvfkdyfpigvavdpsrlndadphaqltakhfnmlvaenamkpeslqpte
    gnftfdnadkivdyaiahnmkmrghtllwhnqvpdwffqdpsdpskpasrdlllqrlrth
    ittvldhfktkygsqnpiigwdvvnevlddngnlrnskwlqiigpdyiekafeyaheadp
    smklfindynienngvktqamydlvkklknegvpingigmqmhisinsnidnikasiekl
    aslgveiqvtaldmnmngdvsndallkqarlykqlfdlfkaekqyitavvfwgvsddvsw
    lskpnapllfdsklqakpaywaiv