PDB entry 3w24

View 3w24 on RCSB PDB site
Description: The high-resolution crystal structure of TsXylA, intracellular xylanase from Thermoanaerobacterium saccharolyticum JW/SL-YS485
Class: hydrolase
Keywords: glycoside hydrolase, xylanase, thermophilic, HYDROLASE
Deposited on 2012-11-27, released 2013-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.175
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 10
    Species: Thermoanaerobacterium saccharolyticum [TaxId:1094508]
    Gene: Tsac_1459
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3w24a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w24A (A:)
    tiqndipdlysvfkdyfpigvavdpsrlndadphaqltakhfnmlvaenamkpeslqpte
    gnftfdnadkivdyaiahnmkmrghtllwhnqvpdwffqdpsdpskpasrdlllqrlrth
    ittvldhfktkygsqnpiigwdvvnevlddngnlrnskwlqiigpdyiekafeyaheadp
    smklfindynienngvktqamydlvkklknegvpingigmqmhisinsnidnikasiekl
    aslgveiqvteldmnmngdvsndallkqarlykqlfdlfkaekqyitavvfwgvsddvsw
    lskpnapllfdsklqakpaywaivdlgkaipdiqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w24A (A:)
    tiqndipdlysvfkdyfpigvavdpsrlndadphaqltakhfnmlvaenamkpeslqpte
    gnftfdnadkivdyaiahnmkmrghtllwhnqvpdwffqdpsdpskpasrdlllqrlrth
    ittvldhfktkygsqnpiigwdvvnevlddngnlrnskwlqiigpdyiekafeyaheadp
    smklfindynienngvktqamydlvkklknegvpingigmqmhisinsnidnikasiekl
    aslgveiqvteldmnmngdvsndallkqarlykqlfdlfkaekqyitavvfwgvsddvsw
    lskpnapllfdsklqakpaywaiv