PDB entry 3w1y

View 3w1y on RCSB PDB site
Description: Crystal structure of T brucei ATG8.2 in complex with E coli S10
Class: transport protein/ribosomal protein
Keywords: Autophage protein 8, Autophage protein 12, ubiquitin fold, TRANSPORT PROTEIN-RIBOSOMAL PROTEIN complex
Deposited on 2012-11-23, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein 1A/1B, light chain 3
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb927.7.3320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w1ya_
  • Chain 'B':
    Compound: Microtubule-associated protein 1A/1B, light chain 3
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb927.7.3320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w1yb_
  • Chain 'C':
    Compound: 30S ribosomal protein S10
    Species: Escherichia coli [TaxId:83333]
    Gene: rpsJ, nusE, b3321, JW3283
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w1yA (A:)
    gshmpshyryqytrsfaeraketesarlrypkhipilceptsaasastprdvrlfstrqq
    vqreldcnkfllpetatvmefmmalrqrllleegqavfvfignelppnsaclgdiyarak
    dpdgflyvsygventfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w1yA (A:)
    hyryqytrsfaeraketesarlrypkhipilceptsvrlfstrqqvqreldcnkfllpet
    atvmefmmalrqrllleegqavfvfignelppnsaclgdiyarakdpdgflyvsygvent
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w1yB (B:)
    gshmpshyryqytrsfaeraketesarlrypkhipilceptsaasastprdvrlfstrqq
    vqreldcnkfllpetatvmefmmalrqrllleegqavfvfignelppnsaclgdiyarak
    dpdgflyvsygventfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w1yB (B:)
    yryqytrsfaeraketesarlrypkhipilceptsdcnkfllpetatvmefmmalrqrll
    leegqavfvfignelppnsaclgdiyarakdpdgflyvsygven
    

  • Chain 'C':
    No sequence available.