PDB entry 3w16

View 3w16 on RCSB PDB site
Description: Structure of Aurora kinase A complexed to pyrazole-aminoquinoline inhibitor III
Class: transferase/transferase inhibitor
Keywords: kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-11-07, released 2014-02-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.235
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3w16a_
  • Heterogens: P9J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w16A (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
    hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
    hnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w16A (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvgtldylppemiegdekvdlwslgvlc
    yeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevle
    hpwitanss