PDB entry 3w06

View 3w06 on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana DWARF14 Like (AtD14L)
Class: hydrolase
Keywords: karrikin signaling, alpha/beta hydrolase, karrikin binding, hydrolase
Deposited on 2012-10-19, released 2013-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.133
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, alpha/beta fold family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g37470, F6G17.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3w06a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w06A (A:)
    gpmgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttn
    pdyfdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmi
    saspryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtl
    fnmrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvv
    evipsdghlpqlsspdsvipvilrhirndiam
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w06A (A:)
    gvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdy
    fdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisas
    pryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnm
    rpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevi
    psdghlpqlsspdsvipvilrhirndi