PDB entry 3vzz

View 3vzz on RCSB PDB site
Description: Crystal structure of PcrB complexed with FsPP from bacillus subtilis subap. subtilis str. 168
Class: transferase
Keywords: biosynthesis, prenyltransferases, enzyme catalysis, TRANSFERASE
Deposited on 2012-10-17, released 2012-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.178
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heptaprenylglyceryl phosphate synthase
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: pcrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vzza_
  • Chain 'B':
    Compound: Heptaprenylglyceryl phosphate synthase
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: pcrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vzzb_
  • Heterogens: MG, CL, FPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vzzA (A:)
    mydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrflv
    pcvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegyci
    anpdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavlet
    stlfygggikdaetakqyaehadvivvgnavyedfdralktvaavkge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vzzA (A:)
    mydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrflv
    pcvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegyci
    anpdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavlet
    stlfygggikdaetakqyaehadvivvgnavyedfdralktvaavk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vzzB (B:)
    mydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrflv
    pcvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegyci
    anpdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavlet
    stlfygggikdaetakqyaehadvivvgnavyedfdralktvaavkge