PDB entry 3vyc

View 3vyc on RCSB PDB site
Description: Crystal structure of unliganded Saccharomyces cerevisiae CRM1 (Xpo1p)
Class: protein transport
Keywords: HEAT repeat, nuclear export, PROTEIN TRANSPORT
Deposited on 2012-09-22, released 2012-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exportin-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CRM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vyca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vycA (A:)
    megildfsndldialldqvvstfyqgsgvqqkqaqeiltkfqdnpdawqkadqilqfstn
    pqskfialsildklitrkwkllpndhrigirnfvvgmiismcqddevfktqknlinksdl
    tlvqilkqewpqnwpefipeligsssssvnvcennmivlkllseevfdfsaeqmtqakal
    hlknsmskefeqifklcfqvleqgsssslivatlesllrylhwipyryiyetnilellst
    kfmtspdtraitlkcltevsnlkipqdndlikrqtvlffqntlqqiatsvmpvtadlkat
    yanangndqsflqdlamflttylarnrallesdeslrelllnahqyliqlskieerelfk
    ttldywhnlvadlfyeplkkhiyeeicsqlrlviienmvrpeevlvvendegeivrefvk
    esdtiqlykserevlvylthlnvidteeimisklarqidgsewswhnintlswaigsisg
    tmsedtekrfvvtvikdlldltvkkrgkdnkavvasdimyvvgqyprflkahwnflrtvi
    lklfefmhethegvqdmacdtfikivqkckyhfviqqpresepfiqtiirdiqkttadlq
    pqqvhtfykacgiiiseersvaernrllsdlmqlpnmawdtiveqstanptllldsetvk
    iianiiktnvavctsmgadfypqlghiyynmlqlyravssmisaqvaaegliatktpkvr
    glrtikkeilklvetyiskarnlddvvkvlvepllnavledymnnvpdardaevlncmtt
    vvekvghmipqgvililqsvfectldminkdfteypehrvefykllkvineksfaaflel
    ppaafklfvdaicwafkhnnrdvevnglqialdlvkniermgnvpfanefhknyffifvs
    etffvltdsdhksgfskqalllmklislvydnktsnqvylsqylanmlsnafphltseqi
    asflsaltkqykdlvvfkgtlrdflvqikevggdptdylfaedkenalmeqnrlerekaa
    kiggllkpseldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vycA (A:)
    awqkadqilqkfialsildklitrkwkllpndhrigirnfvvgmiismcqddevfktqkn
    linksdltlvqilkqewpqnwpefipeligsssssvnvcennmivlkllseevfdfsaeq
    mtqakalhlknsmskefeqifklcfqvleqgsssslivatlesllrylhwipyryiyetn
    ilellstkfmtspdtraitlkcltevsnlkiikrqtvlffqntlqqiatsvmpvtadlka
    tyanangndqsflqdlamflttylarnrallesdeslrelllnahqyliqlskieerelf
    kttldywhnlvadlfyeplkkhiyeeicsqlrlviienmvrpeevlvvendegeivrefv
    kesdtiqlykserevlvylthlnvidteeimisklarqidgsewswhnintlswaigsis
    gtmsedtekrfvvtvikdlldltvkkrgkdnkavvasdimyvvgqyprflkahwnflrtv
    ilklfefmhethegvqdmacdtfikivqkckyhfviqqpresepfiqtiirdiqkttadl
    qpqqvhtfykacgiiiseersvaernrllsdlmqlpnmawdtiveqstanptllldsetv
    kiianiiktnvavctsmgadfypqlghiyynmlqlyravssmisaqvaaegliatktpkv
    rglrtikkeilklvetyiskarnlddvvkvlvepllnavledymnnvpdardaevlncmt
    tvvekvghmipqgvililqsvfectldminkdfteypehrvefykllkvineksfaafle
    lppaafklfvdaicwafkhnnrdvevnglqialdlvkniermgnvpfanefhknyffifv
    setffvltdsdhksgfskqalllmklislvydnktsnqvylsqylanmlsnafphltseq
    iasflsaltkqykdlvvfkgtlrdflvqikevggdptdylfaedkenalmeqnrlereka
    akiggllkpseldd