PDB entry 3vxq

View 3vxq on RCSB PDB site
Description: H27-14 TCR specific for HLA-A24-Nef134-10
Class: immune system
Keywords: hiv-1, nef, immune system, t cell receptor, immunogloburin domain, tcr, immune response
Deposited on 2012-09-20, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H27-14 TCR alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VXQ (Start-204)
    Domains in SCOPe 2.07: d3vxqa1, d3vxqa2
  • Chain 'B':
    Compound: H27-14 TCR beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VXQ (Start-243)
    Domains in SCOPe 2.07: d3vxqb1, d3vxqb2
  • Chain 'D':
    Compound: H27-14 TCR alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VXQ (Start-204)
    Domains in SCOPe 2.07: d3vxqd1, d3vxqd2
  • Chain 'E':
    Compound: H27-14 TCR beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VXQ (Start-243)
    Domains in SCOPe 2.07: d3vxqe1, d3vxqe2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vxqA (A:)
    mkqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqts
    grlnasldkssgrstlyiaasqpgdsatylcavrmdssyklifgsgtrllvrpdiqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffpspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxqA (A:)
    kqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsg
    rlnasldkssgrstlyiaasqpgdsatylcavrmdssyklifgsgtrllvrpdiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vxqB (B:)
    mdtgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksr
    llsdrfsaerpkgsfstleiqrteqgdsamylcassswdtgelffgegsrltvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxqB (B:)
    tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll
    sdrfsaerpkgsfstleiqrteqgdsamylcassswdtgelffgegsrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vxqD (D:)
    mkqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqts
    grlnasldkssgrstlyiaasqpgdsatylcavrmdssyklifgsgtrllvrpdiqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffpspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxqD (D:)
    kqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsg
    rlnasldkssgrstlyiaasqpgdsatylcavrmdssyklifgsgtrllvrpdiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3vxqE (E:)
    mdtgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksr
    llsdrfsaerpkgsfstleiqrteqgdsamylcassswdtgelffgegsrltvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxqE (E:)
    tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll
    sdrfsaerpkgsfstleiqrteqgdsamylcassswdtgelffgegsrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad