PDB entry 3vvw

View 3vvw on RCSB PDB site
Description: NDP52 in complex with LC3C
Class: protein transport
Keywords: autophagy adaptor protein, PROTEIN TRANSPORT
Deposited on 2012-07-28, released 2013-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Calcium-binding and coiled-coil domain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CALCOCO2, NDP52
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13137 (2-End)
• Chain 'B':
  Compound: Microtubule-associated proteins 1A/1B light chain 3C
  Species: Homo sapiens [TaxId:9606]
  Gene: MAP1LC3C
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BXW4 (Start-127)
  Domains in SCOPe 2.04: d3vvwb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3vvwB (B:)
  gpmpppqkipsvrpfkqrkslairqeevagirakfpnkipvvverypretflppldktkf
  lvpqeltmtqflsiirsrmvlrateafyllvnnkslvsmsatmaeiyrdykdedgfvymt
  yasqetfg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3vvwB (B:)
  fkqrkslairqeevagirakfpnkipvvverypretflppldktkflvpqeltmtqflsi
  irsrmvlrateafyllvnnkslvsmsatmaeiyrdykdedgfvymtyasqetfg