PDB entry 3vtt

View 3vtt on RCSB PDB site
Description: High Resolution crystal structure of Dengue 3 Envelope protein domain III (ED3)
Class: viral protein, structural protein
Keywords: immunoglobin like domain, Epitope presentation, cellular attachment, VIRAL PROTEIN, STRUCTURAL PROTEIN
Deposited on 2012-06-07, released 2012-12-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Dengue virus type 3 [TaxId:408870]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3vtta_
  • Chain 'B':
    Compound: Envelope protein E
    Species: Dengue virus type 3 [TaxId:408870]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3vttA (A:)
gsgmsyamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlit
anpvvtkkeepvnieaeppfgesnivigigdkalkinwyrkgssigk

    Sequence, based on observed residues (ATOM records): (download) 
    >3vttA (A:)
syamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpv
vtkkeepvnieaeppfgesnivigigdkalkinwyrkgss

  • Chain 'B':
    No sequence available.