PDB entry 3vsd

View 3vsd on RCSB PDB site
Description: Crystal Structure of the K127A Mutant of O-Phosphoserine Sulfhydrylase Complexed with External Schiff Base of Pyridoxal 5'-Phosphate with O-Acetyl-L-Serine
Class: transferase
Keywords: Cysteine Biosynthesis, External Schiff base of PLP with O-acetylserine, K127A mutant, Sulfhydrylase (inactivated), TRANSFERASE
Deposited on 2012-04-24, released 2012-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein CysO
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE1586, APE_1586, cysO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YBL2
      • engineered mutation (126)
    Domains in SCOPe 2.07: d3vsda_
  • Chain 'B':
    Compound: Protein CysO
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE1586, APE_1586, cysO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YBL2
      • engineered mutation (126)
    Domains in SCOPe 2.07: d3vsdb_
  • Heterogens: PLP, OAS, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vsdA (A:)
    maladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripv
    gdgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewyn
    pfslsvadrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaae
    efgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtar
    eifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrve
    tgmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlep
    gdyvvvvpdtgfkylslvqnalegagdsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vsdA (A:)
    aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
    dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
    fslsvadrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
    fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
    ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
    gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
    dyvvvvpdtgfkylslvqnale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vsdB (B:)
    maladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripv
    gdgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewyn
    pfslsvadrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaae
    efgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtar
    eifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrve
    tgmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlep
    gdyvvvvpdtgfkylslvqnalegagdsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vsdB (B:)
    aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
    dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
    fslsvadrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
    fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
    ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
    gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
    dyvvvvpdtgfkylslvqnaleg