PDB entry 3vrq

View 3vrq on RCSB PDB site
Description: Crystal structure of the tyrosine kinase binding domain of Cbl-c (PL mutant)
Class: protein binding
Keywords: PTB domain, TKB (tyrosine kinase binding) domain, four-helix bundle (4H), calcium-binding EF hand, divergent SH2 domain, Regulator of EGFR mediated signal transduction, Ubiquitously expressed, PROTEIN BINDING
Deposited on 2012-04-13, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal transduction protein CBL-C
    Species: Homo sapiens [TaxId:9606]
    Gene: CBLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULV8
      • engineered mutation (272)
    Domains in SCOPe 2.06: d3vrqa1, d3vrqa2
  • Chain 'B':
    Compound: Signal transduction protein CBL-C
    Species: Homo sapiens [TaxId:9606]
    Gene: CBLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULV8
      • engineered mutation (272)
    Domains in SCOPe 2.06: d3vrqb1, d3vrqb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vrqA (A:)
    gplgspefmalavapwgrqweearalgravrmlqrleeqcvdprlsvsppslrdllprta
    qllrevahsrraaggggpggpggsgdflliylanleaksrqvaallpprgrrsandelfr
    agsrlrrqlaklaiifshmhaelhalfpggkycghmyqltkapahtfwrescgarcvlpw
    aefesllgtchpvepgctalalrttidltcsghvsifefdvftrlfqpwptllknwqlla
    vnhpgymafltydevqerlqacrdkpgsyifrlsctrlgqwaigyvssdgsilqtipank
    plsqvllegqkdgfylypdgkthnpdltelg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vrqA (A:)
    qweearalgravrmlqrleeqcppslrdllprtaqllrevahsrpggpggsgdflliyla
    nleaksrqvaalsrlrrqlaklaiifshmhaelhalfpggkycghmyqltkapahtfwre
    scgarcvlpwaefesllgtchpvepgctalalrttidltcsghvsifefdvftrlfqpwp
    tllknwqllavnhpgymafltydevqerlqacrdkpgsyifrlsctrlgqwaigyvssdg
    silqtipankplsqvllegqkdgfylypdgkthnpdlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vrqB (B:)
    gplgspefmalavapwgrqweearalgravrmlqrleeqcvdprlsvsppslrdllprta
    qllrevahsrraaggggpggpggsgdflliylanleaksrqvaallpprgrrsandelfr
    agsrlrrqlaklaiifshmhaelhalfpggkycghmyqltkapahtfwrescgarcvlpw
    aefesllgtchpvepgctalalrttidltcsghvsifefdvftrlfqpwptllknwqlla
    vnhpgymafltydevqerlqacrdkpgsyifrlsctrlgqwaigyvssdgsilqtipank
    plsqvllegqkdgfylypdgkthnpdltelg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vrqB (B:)
    weearalgravrmlqrleeqcvsppslrdllprtaqllrevahsrrapggpggsgdflli
    ylanleaksrqvaalrlrrqlaklaiifshmhaelhalfpggkycghmyqltkapahtfw
    rescgarcvlpwaefesllgtchptalalrttidltcsghvsifefdvftrlfqpwptll
    knwqllavnhpgymafltydevqerlqacrdkpgsyifrlsctrlgqwaigyvssdgsil
    qtipankplsqvllegqkdgfylypdgkthnpdlt