PDB entry 3vph

View 3vph on RCSB PDB site
Description: L-lactate dehydrogenase from Thermus caldophilus GK24 complexed with oxamate, NADH and FBP
Class: oxidoreductase
Keywords: Rossmann fold, Dehydrogenase, OXIDOREDUCTASE
Deposited on 2012-03-01, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Thermus caldophilus [TaxId:272]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vpha1, d3vpha2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Thermus caldophilus [TaxId:272]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vphb1, d3vphb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Thermus caldophilus [TaxId:272]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vphc1, d3vphc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Thermus caldophilus [TaxId:272]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vphd1, d3vphd2
  • Heterogens: OXM, FBP, NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vphA (A:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsalppgrvvgsgtildtarfrallaehlrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vphB (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsalppgrvvgsgtildtarfrallaehlrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vphC (C:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsalppgrvvgsgtildtarfrallaehlrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vphD (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsalppgrvvgsgtildtarfrallaehlrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf