PDB entry 3vm7

View 3vm7 on RCSB PDB site
Description: Structure of an Alpha-Amylase from Malbranchea cinnamomea
Class: hydrolase
Keywords: Malbranchea cinnamomea C -Amylase CModels, Protein Conformation, HYDROLASE
Deposited on 2011-12-09, released 2013-05-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.147
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Malbranchea cinnamomea [TaxId:5041]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VM7
    Domains in SCOPe 2.06: d3vm7a1, d3vm7a2
  • Heterogens: CA, NAG, GLC, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vm7A (A:)
    mvstalfllaaaagsarfakaatpdewrsrsiyqvltdrfargdgspdapcdtgarkycg
    gnyrglisqldyiqgmgfdsvwispitkqfeddwngapyhgywqtdlyalnehfgteedl
    raladelhargmflmvdvvinhngwpgdaasidysqfnpfnssdyyhppceinyddqtsv
    eqcwlytganalpdlktedphvsqvhndwiadlvskysidglridttkhvdkpaigsfnd
    aagvyavgevyhgdpaytcpyqdwvdgvlnfpvyyplidafkspsgtmwslvdninkvfq
    tcndprllgtfsenhdiprfasytqdlalaknvlaftilfdgipivyagqeqqysgdsdp
    ynrealwlsgfntdaplykhiaacnrirshavsnddayittptdikysddhtlalvkgav
    ttvltnaganagettvtveatgyasgeqvtdvlscesiaasdggrlsvtlnqglprvffp
    tdalagsglcen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vm7A (A:)
    atpdewrsrsiyqvltdrfargdgspdapcdtgarkycggnyrglisqldyiqgmgfdsv
    wispitkqfeddwngapyhgywqtdlyalnehfgteedlraladelhargmflmvdvvin
    hngwpgdaasidysqfnpfnssdyyhppceinyddqtsveqcwlytganalpdlktedph
    vsqvhndwiadlvskysidglridttkhvdkpaigsfndaagvyavgevyhgdpaytcpy
    qdwvdgvlnfpvyyplidafkspsgtmwslvdninkvfqtcndprllgtfsenhdiprfa
    sytqdlalaknvlaftilfdgipivyagqeqqysgdsdpynrealwlsgfntdaplykhi
    aacnrirshavsnddayittptdikysddhtlalvkgavttvltnaganagettvtveat
    gyasgeqvtdvlscesiaasdggrlsvtlnqglprvffptdalagsglce