PDB entry 3vm5

View 3vm5 on RCSB PDB site
Description: Recombinant medaka fish alpha-amylase expressed in yeast Pichia pastoris
Class: hydrolase
Keywords: (alpha/beta)8 barrel fold, starch hydrolysis, HYDROLASE
Deposited on 2011-12-08, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.18
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Oryzias latipes [TaxId:8090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VM5 (0-End)
    Domains in SCOPe 2.07: d3vm5a1, d3vm5a2, d3vm5a3
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vm5A (A:)
    qhnpntrdgrtaivhlfewrwadiaaecerflgpkgfagvqisppnehilvsspwrpwwq
    ryqpisynlcsrsggenelrdmitrcnnvgvnvyvdavinhmcgagggegthsscgswfn
    annkdfpsvpysnldfndgkcktgsgnienygdpyqvrdcrlvglldlalekdyvrgkva
    dfmnklidmgvagfrvdackhmwpgdldnvyrrlnnlntkwfpggsrpfifqevidlgge
    pittgeyvglgrvtefkygarlgelfrkwngqklsytknwgegwgfmadgnavvftdnhd
    nqrghgaggasiltfwdprlykmavgymlahpygftrvmssyswdrnfvngkdendwigp
    psngdgstkpvpinpdqtcgdgwvcehrwrqimnmvqfrnvvngqphanwwdngnnqvaf
    grgnrgfivfnnddwaldvtlntglpggtycdvisgnkdggsctgkqitvggdgrahfyi
    nnseedpfiaihadsklhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vm5A (A:)
    qhnpntrdgrtaivhlfewrwadiaaecerflgpkgfagvqisppnehilvsspwrpwwq
    ryqpisynlcsrsggenelrdmitrcnnvgvnvyvdavinhmcgagggegthsscgswfn
    annkdfpsvpysnldfndgkcktgsgnienygdpyqvrdcrlvglldlalekdyvrgkva
    dfmnklidmgvagfrvdackhmwpgdldnvyrrlnnlntkwfpggsrpfifqevidlgge
    pittgeyvglgrvtefkygarlgelfrkwngqklsytknwgegwgfmadgnavvftdnhd
    nqrghgaggasiltfwdprlykmavgymlahpygftrvmssyswdrnfvngkdendwigp
    psngdgstkpvpinpdqtcgdgwvcehrwrqimnmvqfrnvvngqphanwwdngnnqvaf
    grgnrgfivfnnddwaldvtlntglpggtycdvisgnkdggsctgkqitvggdgrahfyi
    nnseedpfiaihadsklhh