PDB entry 3vlg

View 3vlg on RCSB PDB site
Description: Crystal structure of the W150A mutant LOX-1 CTLD showing impaired OxLDL binding
Class: lipid binding protein
Keywords: C-type lectin-like domain, oxidized LDL receptor, membrane protein, lipid binding protein
Deposited on 2011-12-01, released 2012-04-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidized low-density lipoprotein receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: OLR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78380
      • engineered mutation (21)
    Domains in SCOPe 2.04: d3vlga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vlgA (A:)
    gphmtlkrvancsapcpqdwiahgencylfssgsfnweksqekclsldakllkinstadl
    dfiqqaisyssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqr
    gavyaencilaafsicqkkanlraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vlgA (A:)
    pcpqdwiahgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfpf
    wmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaafs
    icqkka