PDB entry 3vii

View 3vii on RCSB PDB site
Description: Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with Bis-Tris
Class: hydrolase
Keywords: cellulases, glycosyl hydrolase, hydrolase
Deposited on 2011-10-03, released 2012-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.128
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Neotermes koshunensis [TaxId:60586]
    Gene: NkBG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3viia_
  • Heterogens: BTB, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3viiA (A:)
    mdvassdtvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdi
    addsyhlykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellang
    iepmvtmyhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfnepltfmd
    gyaseigmapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcep
    atnsaedrascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqfta
    eeveyirgthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvp
    wgfrkelnwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvi
    gytawslmdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrdl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3viiA (A:)
    tvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdiaddsyhl
    ykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellangiepmvtm
    yhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfnepltfmdgyaseig
    mapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcepatnsaed
    rascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqftaeeveyir
    gthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvpwgfrkel
    nwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvigytawsl
    mdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrd