PDB entry 3vi5

View 3vi5 on RCSB PDB site
Description: Human hematopoietic prostaglandin D synthase inhibitor complex structures
Class: Isomerase/Isomerase Inhibitor
Keywords: sigma class glutathione S transferase(GST), isomerase, glutathione S transferase, Ca binding, GSH binding, prostaglandin H2 binding, Isomerase-Isomerase Inhibitor complex
Deposited on 2011-09-21, released 2012-04-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760
      • engineered mutation (142)
    Domains in SCOPe 2.05: d3vi5a1, d3vi5a2
  • Chain 'B':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760
      • engineered mutation (142)
    Domains in SCOPe 2.05: d3vi5b1, d3vi5b2
  • Chain 'C':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760
      • engineered mutation (142)
    Domains in SCOPe 2.05: d3vi5c1, d3vi5c2
  • Chain 'D':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760 (0-197)
      • engineered mutation (142)
    Domains in SCOPe 2.05: d3vi5d1, d3vi5d2
  • Heterogens: GSH, CA, M4M, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vi5A (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vi5B (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vi5C (C:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vi5D (D:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl