PDB entry 3vi3

View 3vi3 on RCSB PDB site
Description: Crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
Class: cell adhesion/immune system
Keywords: beta propeller fold, Rossmann fold, beta sandwich, Fibronectin receptor, CELL ADHESION-IMMUNE SYSTEM complex
Deposited on 2011-09-21, released 2012-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-5
    Species: Homo sapiens [TaxId:9606]
    Gene: FNRA, ITGA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vi3a1, d3vi3a2
  • Chain 'B':
    Compound: Integrin beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: FNRB, ITGB1, MDF2, MSK12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05556 (Start-444)
      • see remark 999 (91)
      • see remark 999 (194)
  • Chain 'C':
    Compound: Integrin alpha-5
    Species: Homo sapiens [TaxId:9606]
    Gene: FNRA, ITGA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vi3c1, d3vi3c2
  • Chain 'D':
    Compound: Integrin beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: FNRB, ITGB1, MDF2, MSK12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05556 (Start-444)
      • see remark 999 (91)
      • see remark 999 (194)
  • Chain 'E':
    Compound: SG/19 Fab fragment (Light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VI3 (0-218)
    Domains in SCOPe 2.07: d3vi3e1, d3vi3e2
  • Chain 'F':
    Compound: SG/19 Fab fragment (Heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VI3 (0-217)
  • Chain 'H':
    Compound: SG/19 Fab fragment (Heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VI3 (0-217)
  • Chain 'L':
    Compound: SG/19 Fab fragment (Light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VI3 (0-218)
    Domains in SCOPe 2.07: d3vi3l1, d3vi3l2
  • Heterogens: CA, NAG, BMA, MAN, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vi3A (A:)
    fnldaeapavlsgppgsffgfsvefyrpgtdgvsvlvgapkantsqpgvlqggavylcpw
    gasptqctpiefdskgsrllesslsssegeepveykslqwfgatvrahgssilacaplys
    wrtekeplsdpvgtcylstdnftrileyapcrsdfswaagqgycqggfsaeftktgrvvl
    ggpgsyfwqgqilsatqeqiaesyypeylinlvqgqlqtrqassiyddsylgysvavgef
    sgddtedfvagvpkgnltygyvtilngsdirslynfsgeqmasyfgyavaatdvngdgld
    dllvgapllmdrtpdgrpqevgrvyvylqhpagieptptltltghdefgrfgssltplgd
    ldqdgyndvaigapfggetqqgvvfvfpggpgglgskpsqvlqplwaashtpdffgsalr
    ggrdldgngypdlivgsfgvdkavvyrgrpivsasasltifpamfnpeerscslegnpva
    cinlsfclnasgkhvadsigftvelqldwqkqkggvrralflasrqatltqtlliqngar
    edcremkiylrnesefrdklspihialnfsldpqapvdshglrpalhyqsksriedkaqi
    lldcgednicvpdlqlevfgeqngglenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vi3A (A:)
    fnldaeapavlsgppgsffgfsvefyrpgtdgvsvlvgapkantsqpgvlqggavylcpw
    gasptqctpiefdskgsrllesslsssegeepveykslqwfgatvrahgssilacaplys
    wrtekeplsdpvgtcylstdnftrileyapcrsdfswaagqgycqggfsaeftktgrvvl
    ggpgsyfwqgqilsatqeqiaesyypeylinlvqgqlqtrqassiyddsylgysvavgef
    sgddtedfvagvpkgnltygyvtilngsdirslynfsgeqmasyfgyavaatdvngdgld
    dllvgapllmdrtpdgrpqevgrvyvylqhpagieptptltltghdefgrfgssltplgd
    ldqdgyndvaigapfggetqqgvvfvfpggpgglgskpsqvlqplwaashtpdffgsalr
    ggrdldgngypdlivgsfgvdkavvyrgrpivsasasltifpamfnpeerscslegnpva
    cinlsfclnasgkhvadsigftvelqldwqkqkggvrralflasrqatltqtlliqngar
    edcremkiylrnesefrdklspihialnfsldpqapvdshglrpalhyqsksriedkaqi
    l
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vi3C (C:)
    fnldaeapavlsgppgsffgfsvefyrpgtdgvsvlvgapkantsqpgvlqggavylcpw
    gasptqctpiefdskgsrllesslsssegeepveykslqwfgatvrahgssilacaplys
    wrtekeplsdpvgtcylstdnftrileyapcrsdfswaagqgycqggfsaeftktgrvvl
    ggpgsyfwqgqilsatqeqiaesyypeylinlvqgqlqtrqassiyddsylgysvavgef
    sgddtedfvagvpkgnltygyvtilngsdirslynfsgeqmasyfgyavaatdvngdgld
    dllvgapllmdrtpdgrpqevgrvyvylqhpagieptptltltghdefgrfgssltplgd
    ldqdgyndvaigapfggetqqgvvfvfpggpgglgskpsqvlqplwaashtpdffgsalr
    ggrdldgngypdlivgsfgvdkavvyrgrpivsasasltifpamfnpeerscslegnpva
    cinlsfclnasgkhvadsigftvelqldwqkqkggvrralflasrqatltqtlliqngar
    edcremkiylrnesefrdklspihialnfsldpqapvdshglrpalhyqsksriedkaqi
    lldcgednicvpdlqlevfgeqngglenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vi3C (C:)
    fnldaeapavlsgppgsffgfsvefyrpgtdgvsvlvgapkantsqpgvlqggavylcpw
    gasptqctpiefdskgsrllesslsssegeepveykslqwfgatvrahgssilacaplys
    wrtekeplsdpvgtcylstdnftrileyapcrsdfswaagqgycqggfsaeftktgrvvl
    ggpgsyfwqgqilsatqeqiaesyypeylinlvqgqlqtrqassiyddsylgysvavgef
    sgddtedfvagvpkgnltygyvtilngsdirslynfsgeqmasyfgyavaatdvngdgld
    dllvgapllmdrtpdgrpqevgrvyvylqhpagieptptltltghdefgrfgssltplgd
    ldqdgyndvaigapfggetqqgvvfvfpggpgglgskpsqvlqplwaashtpdffgsalr
    ggrdldgngypdlivgsfgvdkavvyrgrpivsasasltifpamfnpeerscslegnpva
    cinlsfclnasgkhvadsigftvelqldwqkqralflasrqatltqtlliqngaredcre
    mkiylrnelspihialnfsldpqapvdshglrpalhyqsksriedkaqi
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vi3E (E:)
    divmtqatpsipvtpgesvsiscrsnksllhsngntylywflqrpgqsprllifrmsnla
    sgvpdrfsgsgsgtaftlrisrveaadvgiyfclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vi3L (L:)
    divmtqatpsipvtpgesvsiscrsnksllhsngntylywflqrpgqsprllifrmsnla
    sgvpdrfsgsgsgtaftlrisrveaadvgiyfclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec